Partial recombinant corresponding to aa1-90 from human FABP2 (NP_000125.1) with GST tag. MW of the GST tag alone is 26kD.
FABP2, also known as intestinal fatty acid binding protein 2 (I-FABP), is expressed in the epithelium of the small intestine by mature enterocytes. FABP2 is thought to facilitate of cellular uptake and transport of long-chain fatty acids within enterocytes and may also help maintain energy homeostasis by functioning as a lipid sensor. This protein binds saturated long-chain fatty acid with a high affinity, but binds with a low affinity to unsaturated long-chain fatty acid. The Ala to Thr substitution at residue 54 of FABP2 is associated with higher total cholesterol, with stroke incidence, elevation of fasting and postprandial triglyceride, insulin resistance, and higher nonesterified fatty acid (NEFA) concentrations. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKL Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.