Partial recombinant corresponding to aa1-90 from human FABP2 (NP_000125.1) with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)490 is a new Blue-Green photostable dye conjugate comparable to DyLight(TM)488, Alexa Fluor(TM)488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm), Emission (515nm), Extinction Coefficient 73,000. FABP2, also known as intestinal fatty acid binding protein 2 (I-FABP), is expressed in the epithelium of the small intestine by mature enterocytes. FABP2 is thought to facilitate of cellular uptake and transport of long-chain fatty acids within enterocytes and may also help maintain energy homeostasis by functioning as a lipid sensor. This protein binds saturated long-chain fatty acid with a high affinity, but binds with a low affinity to unsaturated long-chain fatty acid. The Ala to Thr substitution at residue 54 of FABP2 is associated with higher total cholesterol, with stroke incidence, elevation of fasting and postprandial triglyceride, insulin resistance, and higher nonesterified fatty acid (NEFA) concentrations. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKL Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
