FABP6 (Intestinal Bile Acid-binding Protein, I-BABP, Intestinal 15kD Protein, I-15P, Ileal Lipid-binding Protein, ILBP, Fatty Acid-binding Protein 6, Gastrotropin, GT, ILBP, ILLBP) (Biotin), Clone: [4A4], Mouse, Monoclonal100 u

Catalog Number: USB-126557-BIOTIN
Article Name: FABP6 (Intestinal Bile Acid-binding Protein, I-BABP, Intestinal 15kD Protein, I-15P, Ileal Lipid-binding Protein, ILBP, Fatty Acid-binding Protein 6, Gastrotropin, GT, ILBP, ILLBP) (Biotin), Clone: [4A4], Mouse, Monoclonal100 u
Biozol Catalog Number: USB-126557-BIOTIN
Supplier Catalog Number: 126557-Biotin
Alternative Catalog Number: USB-126557-BIOTIN-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: Full length recombinant corresponding to aa1-128 from human FABP6 (AAH22489) with GST tag. MW of the GST tag alone is 26kD.
FABP6 is the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [4A4]
NCBI: 022489
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.