GNRH1 (Gonadotropin-releasing Hormone GnRH, GRH, Gonadotrophin Releasing Hormone 1, GnRH-I, Gonadoliberin I, Gonadoliberin-1, Gonadorelin, Luliberin I, Luteinizing Hormorne Releasing Hormone, LHRH, LH-RH I, LNRH, Luteinizing Relea

Catalog Number: USB-127447-HRP
Article Name: GNRH1 (Gonadotropin-releasing Hormone GnRH, GRH, Gonadotrophin Releasing Hormone 1, GnRH-I, Gonadoliberin I, Gonadoliberin-1, Gonadorelin, Luliberin I, Luteinizing Hormorne Releasing Hormone, LHRH, LH-RH I, LNRH, Luteinizing Relea
Biozol Catalog Number: USB-127447-HRP
Supplier Catalog Number: 127447-HRP
Alternative Catalog Number: USB-127447-HRP-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: Full length human GNRH1, aa1-92 (NP_000816.1).
GNRH1 stimulates the secretion of gonadotropins, it stimulates the secretion of both luteinizing and follicle-stimulating hormones. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
NCBI: 000825
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).