HOOK3 (Protein Hook Homolog 3, h-hook3, hHK3, FLJ31058) (Biotin), Clone: [3A5], Mouse, Monoclonal

Catalog Number: USB-128002-BIOTIN
Article Name: HOOK3 (Protein Hook Homolog 3, h-hook3, hHK3, FLJ31058) (Biotin), Clone: [3A5], Mouse, Monoclonal
Biozol Catalog Number: USB-128002-BIOTIN
Supplier Catalog Number: 128002-Biotin
Alternative Catalog Number: USB-128002-BIOTIN-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, IHC, WB
Immunogen: Partial recombinant corresponding to aa622-719 from human HOOK3 (NP_115786) with GST tag. MW of the GST tag alone is 26kD.
Probably serves as a target for the spiC protein from Salmonella typhimurium, which inactivates it, leading to a strong alteration in cellular trafficking. Component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). May regulate clearance of endocytosed receptors such as MSR1. Participates in defining the architecture and localization of the Golgi complex. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: QNQGAAPEIQALKNQLQERDRLFHSLEKEYEKTKSQREMEEKYIVSAWYNMGMTLHKKAAEDRLASTGSGQSFLARQRQATSSRRSYPGHVQPATAR Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [3A5]
NCBI: 032410
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.