HOPX (Homeodomain-only Protein, Lung Cancer-associated Y Protein, Not Expressed in Choriocarcinoma Protein 1, Odd Homeobox Protein 1, HOPX, HOD, HOP, LAGY, NECC1, OB1, MGC20820), Clone: [3D6], Mouse, Monoclonal

Catalog Number: USB-128003
Article Name: HOPX (Homeodomain-only Protein, Lung Cancer-associated Y Protein, Not Expressed in Choriocarcinoma Protein 1, Odd Homeobox Protein 1, HOPX, HOD, HOP, LAGY, NECC1, OB1, MGC20820), Clone: [3D6], Mouse, Monoclonal
Biozol Catalog Number: USB-128003
Supplier Catalog Number: 128003
Alternative Catalog Number: USB-128003-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: Full length recombinant protein corresponding to aa1-73 from human HOP with GST tag. MW of the GST tag alone is 26kD.
Atypical homeodomain protein which does not bind DNA and is required to modulate cardiac growth and development. Acts via its interaction with SRF, thereby modulating the expression of SRF-dependent cardiac-specific genes and cardiac development. Prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF. Overexpression causes cardiac hypertrophy. May act as a tumor suppressor. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [3D6]
NCBI: 014225
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.4.