IGFBP1 (Insulin-like Growth Factor-binding Protein 1, IBP-1, IGF-binding Protein 1, IGFBP-1, Placental Protein 12, PP12, IBP1) (APC), Clone: [2F9], Mouse, Monoclonal

Catalog Number: USB-128335-APC
Article Name: IGFBP1 (Insulin-like Growth Factor-binding Protein 1, IBP-1, IGF-binding Protein 1, IGFBP-1, Placental Protein 12, PP12, IBP1) (APC), Clone: [2F9], Mouse, Monoclonal
Biozol Catalog Number: USB-128335-APC
Supplier Catalog Number: 128335-APC
Alternative Catalog Number: USB-128335-APC-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Partial recombinant corresponding to aa160-259 from human IGFBP1 (NP_000587) with GST tag. MW of the GST tag alone is 26kD.
Human IGF-BP1 is a cysteine-rich secreted protein expressed in liver, decidual, and kidneys and is the most abundant IGF-BP in amniotic fluid. Levels of IGF-BP1 in serum are lowest after food. IGF-BP1 binds both IGF-I and IGF-II with equal affinity. Phosphorylated IGF-BP1 hinders IGF actions, whereas nonphosphorylated IGF-BP1 is stimulatory. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: GSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2F9]
NCBI: 000596
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).