IHH (Indian Hedgehog Protein, HHG-2, Indian Hedgehog Protein N-product, Indian Hedgehog Protein C-product) (APC), Clone: [2G9], Mouse, Monoclonal

Catalog Number: USB-128360-APC
Article Name: IHH (Indian Hedgehog Protein, HHG-2, Indian Hedgehog Protein N-product, Indian Hedgehog Protein C-product) (APC), Clone: [2G9], Mouse, Monoclonal
Biozol Catalog Number: USB-128360-APC
Supplier Catalog Number: 128360-APC
Alternative Catalog Number: USB-128360-APC-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Full length recombinant corresponding to aa119-217 from human IHH (AAH34757) with GST tag. MW of the GST tag alone is 26kD.
Ihh (Indian hedgehog) is a critical and possibly direct regulator of joint development. In its absence, distribution and function of Gdf5-expressing interzone-associated cells are abnormal. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: ESGARVALSAVRPGDRVLAMGEDGSPTFSDVLIFLDREPHRLRAFQVIETQDPPRRLALTPAHLLFTADNHTEPAARFRATFASHVQPGQYVLVAGVPG Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2G9]
NCBI: 034757
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).