MLL4 (Histone-lysine N-methyltransferase MLL4, Lysine N-methyltransferase 2D, KMT2D, Myeloid/Lymphoid or Mixed-lineage Leukemia Protein 4 Trithorax Homolog 2, WW Domain-binding Protein 7, WBP-7, WBP7, HRX2, KIAA0304, KMT2D, MLL2,
Biozol Catalog Number:
USB-129723-ML550
Supplier Catalog Number:
129723-ML550
Alternative Catalog Number:
USB-129723-ML550-100
Manufacturer:
US Biological
Host:
Mouse
Category:
Antikörper
Application:
FLISA, WB
Immunogen:
Partial recombinant corresponding to aa813-905 from MLL4 (NP_055542) with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor(TM)546, 555, DyLight(TM)549 , Cy3(TM), TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm), Emission (575nm), Extinction Coefficient 150,000. MLL4 contains multiple domains including a CXXC zinc finger, three PHD zinc fingers, two FY-rich domains, and a SET (suppressor of variegation, enhancer of zeste, and trithorax) domain. The SET domain is a conserved C-terminal domain that characterizes proteins of the MLL (mixed-lineage leukemia) family. This gene is ubiquitously expressed in adult tissues. It is also amplified in solid tumor cell lines, and may be involved in human cancer. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KVAASMPLSPGGQMEEVAGAVKQISDRGPVRSEDESVEAKRERPSGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDRQDL* Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.