NUDT21 (Cleavage and Polyadenylation Specificity Factor Subunit 5, Cleavage and Polyadenylation Specificity Factor 25kD Subunit, CPSF 25kD Subunit, Pre-mRNA Cleavage Factor Im 25kD Subunit, Nucleoside Diphosphate-linked Moiety X M

Catalog Number: USB-130632-ML650
Article Name: NUDT21 (Cleavage and Polyadenylation Specificity Factor Subunit 5, Cleavage and Polyadenylation Specificity Factor 25kD Subunit, CPSF 25kD Subunit, Pre-mRNA Cleavage Factor Im 25kD Subunit, Nucleoside Diphosphate-linked Moiety X M
Biozol Catalog Number: USB-130632-ML650
Supplier Catalog Number: 130632-ML650
Alternative Catalog Number: USB-130632-ML650-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, IF, IHC, WB
Immunogen: Full length recombinant corresponding to aa1-228 from human NUDT21 (AAH01403) with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor(TM)647, DyLight(TM)649, Cy5(TM) and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm), Emission (676nm), Extinction Coefficient 250,000. CPSF5 is one subunit of a cleavage factor required for 3 RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3 end processing complex and facilitates the recruitement of other processing factors. CPSF5 is the 25kD subunit of the protein complex, which is composed of four polypeptides. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [3F8]
NCBI: 001403
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)650.