NUDT3 (Diphosphoinositol Polyphosphate Phosphohydrolase 1, DIPP-1, Diadenosine 5,5-P1,P6-hexaphosphate Hydrolase 1, Nucleoside Diphosphate-linked Moiety X Motif 3, Nudix Motif 3, DIPP, DIPP1), Clone: [3C5], Mouse, Monoclonal100

Catalog Number: USB-130633
Article Name: NUDT3 (Diphosphoinositol Polyphosphate Phosphohydrolase 1, DIPP-1, Diadenosine 5,5-P1,P6-hexaphosphate Hydrolase 1, Nucleoside Diphosphate-linked Moiety X Motif 3, Nudix Motif 3, DIPP, DIPP1), Clone: [3C5], Mouse, Monoclonal100
Biozol Catalog Number: USB-130633
Supplier Catalog Number: 130633
Alternative Catalog Number: USB-130633-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: Full length recombinant corresponding to aa1-173 from NUDT3 (AAH07727, ) with GST tag. MW of the GST tag alone is 26kD.
Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. InsP6 (inositol hexakisphophate) is not a substrate. Acts as a negative regulator of the ERK1/2 pathway. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5-phosphoribose 1-diphosphate. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Seqeuence: MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR* Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [3C5]
NCBI: 007727
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.