NUP43 (Nucleoporin Nup43, Nup107-160 Subcomplex Subunit Nup43, p42, FLJ13287, bA350J20.1, p42) (FITC), Clone: [2G5], Mouse, Monoclonal

Catalog Number: USB-130649-FITC
Article Name: NUP43 (Nucleoporin Nup43, Nup107-160 Subcomplex Subunit Nup43, p42, FLJ13287, bA350J20.1, p42) (FITC), Clone: [2G5], Mouse, Monoclonal
Biozol Catalog Number: USB-130649-FITC
Supplier Catalog Number: 130649-FITC
Alternative Catalog Number: USB-130649-FITC-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Partial recombinant protein corresponding to aa281-381 from human NUP43 with GST tag. MW of the GST tag alone is 26kD.
NUP43 probably mediates the assembly of subdomains of the nuclear pore complex (NPC) or facilitates the interaction of transport complexes with the NPC. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SEDGSLWHWDASTDVPEKSSLFHQGGRSSTFLSHSISNQANVHQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAIYVTRHLFS* Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2G5]
NCBI: 024647
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).