NUP50 (NUP50, NPAP60L, Nuclear Pore Complex Protein Nup50, 50kD Nucleoporin, Nuclear Pore-associated Protein 60kD-like, Nucleoporin Nup50, MGC39961) (Biotin), Clone: [4H7], Mouse, Monoclonal

Catalog Number: USB-130651-BIOTIN
Article Name: NUP50 (NUP50, NPAP60L, Nuclear Pore Complex Protein Nup50, 50kD Nucleoporin, Nuclear Pore-associated Protein 60kD-like, Nucleoporin Nup50, MGC39961) (Biotin), Clone: [4H7], Mouse, Monoclonal
Biozol Catalog Number: USB-130651-BIOTIN
Supplier Catalog Number: 130651-Biotin
Alternative Catalog Number: USB-130651-BIOTIN-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: Partial recombinant corresponding to aa342-439 from human NUP50 (NP_705931) with GST tag. MW of the GST tag alone is 26kD.
The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKD Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [4H7]
NCBI: 153645
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.