NUPL1 (Nucleoporin p58/p45, Nucleoporin-like Protein 1, KIAA0410), Clone: [3G11], Mouse, Monoclonal

Catalog Number: USB-130659
Article Name: NUPL1 (Nucleoporin p58/p45, Nucleoporin-like Protein 1, KIAA0410), Clone: [3G11], Mouse, Monoclonal
Biozol Catalog Number: USB-130659
Supplier Catalog Number: 130659
Alternative Catalog Number: USB-130659-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, IF, IHC, WB
Immunogen: Partial recombinant corresponding to aa323-422 from NUPL1 (NP_054808) with GST tag. MW of the GST tag alone is 26kD.
Component of the nuclear pore complex, a complex required for the trafficking across the nuclear membrane. Applications: Suitable for use in ELISA, Immunohistochemistry, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: EIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENVKVLKEQYLGYRK Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [3G11]
NCBI: 014089
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.