PEX11B (Peroxisomal Membrane Protein 11B, Peroxin-11B, Peroxisomal Biogenesis Factor 11B, Protein PEX11 Homolog beta, PEX11-beta) (PE), Clone: [2D2], Mouse, Monoclonal

Catalog Number: USB-131166-PE
Article Name: PEX11B (Peroxisomal Membrane Protein 11B, Peroxin-11B, Peroxisomal Biogenesis Factor 11B, Protein PEX11 Homolog beta, PEX11-beta) (PE), Clone: [2D2], Mouse, Monoclonal
Biozol Catalog Number: USB-131166-PE
Supplier Catalog Number: 131166-PE
Alternative Catalog Number: USB-131166-PE-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, IHC
Immunogen: Partial recombinant corresponding to aa1-99 from PEX11B (NP_003837) with GST tag. MW of the GST tag alone is 26kD.
Involved in peroxisomal proliferation. May regulate peroxisomes division by recruiting the dynamin-related GTPase DNM1L to the peroxisomal membrane. Applications: Suitable for use in FLISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MDAWVRFSAQSQARERLCRAAQYACSLLGHALQRHGASPELQKQIRQLESHLSLGRKLLRLGNSADALESAKRAVHLSDVVLRFCITVSHLNRALYFA Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2D2]
NCBI: 003846
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).