PEX12 (PAF3, Peroxisome Assembly Protein 12, Peroxin-12, Peroxisome Assembly Factor 3, PAF-3) (MaxLight 550), Clone: [2G6], Mouse, Monoclonal

Catalog Number: USB-131167-ML550
Article Name: PEX12 (PAF3, Peroxisome Assembly Protein 12, Peroxin-12, Peroxisome Assembly Factor 3, PAF-3) (MaxLight 550), Clone: [2G6], Mouse, Monoclonal
Biozol Catalog Number: USB-131167-ML550
Supplier Catalog Number: 131167-ML550
Alternative Catalog Number: USB-131167-ML550-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA
Immunogen: Full length recombinant corresponding to aa1-360 from human PEX12 (AAH31085) with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor(TM)546, 555, DyLight(TM)549 , Cy3(TM), TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm), Emission (575nm), Extinction Coefficient 150,000. Required for protein import into peroxisomes. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAEHGAHFTAASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPTHYGFLWRWFDEIFTLLDLLLQQHYLSRTSASFSENFYGLKRIVMGDTHKSQRLASAGLPKQQLWKSIMFLVLLPYLKVKLEKLVSSLREEDEYSIHPPSSRWKRFYRAFLAAYPFVNMAWEGWFLVQQLRYILGKAQHHSPLLRLAGVQLGRLTVQDIQALEHKPAKASMMQQPARSVSEKINSALKKAVGGVALSLSTGLSVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKMKTVCPLCRKTRVNDTVLATSGYVFCYRCVFHYVRSHQACPITGYPTEVQHLIKLYSPEN Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2G6]
NCBI: 031085
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)550.