PEX14 (Peroxisomal Membrane Protein PEX14, PTS1 Receptor-docking Protein, Peroxin-14, Peroxisomal Membrane Anchor Protein PEX14, MGC12767) (FITC), Clone: [1G12], Mouse, Monoclonal

Catalog Number: USB-131168-FITC
Article Name: PEX14 (Peroxisomal Membrane Protein PEX14, PTS1 Receptor-docking Protein, Peroxin-14, Peroxisomal Membrane Anchor Protein PEX14, MGC12767) (FITC), Clone: [1G12], Mouse, Monoclonal
Biozol Catalog Number: USB-131168-FITC
Supplier Catalog Number: 131168-FITC
Alternative Catalog Number: USB-131168-FITC-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Partial recombinant corresponding to aa293-376 from human PEX14 (NP_004556) with GST tag. MW of the GST tag alone is 26kD.
Component of the peroxisomal translocation machinery with PEX13 and PEX17. Interacts with both the PTS1 and PTS2 receptors. Binds directly to PEX17. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LGPQEEGEGVVDVKGQVRMEVQGEEEKREDKEDEEDEEDDDVSHVDEEDCLGVQREDRRGGDGQINEQVEKLRRPEGASNESE Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [1G12]
NCBI: 004565
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).