PEX26 (Peroxisome Assembly Protein 26, Peroxin-26, FLJ20695, PEX26M1T, Pex26pM1T), Mouse

Catalog Number: USB-131173
Article Name: PEX26 (Peroxisome Assembly Protein 26, Peroxin-26, FLJ20695, PEX26M1T, Pex26pM1T), Mouse
Biozol Catalog Number: USB-131173
Supplier Catalog Number: 131173
Alternative Catalog Number: USB-131173-50
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: WB
Immunogen: Full length human PEX26, aa1-305 (NP_060399.1).
Probably required for protein import into peroxisomes. Anchors PEX1 and PEX6 to peroxisome membranes, possibly to form heteromeric AAA ATPase complexes required for the import of proteins into peroxisomes. Involved in the import of catalase and proteins containing a PTS2 target sequence, but not in import of proteins with a PTS1 target sequence. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKSDSSTSAAPLRGLGGPLRSSEPVRAVPARAPAVDLLEEAADLLVVHLDFRAALETCERAWQSLANHAVAEEPAGTSLEVKCSLCVVGIQALAEMDRWQEVLSWVLQYYQVPEKLPPKVLELCILLYSKMQEPGAVLDVVGAWLQDPANQNLPEYGALAEFHVQRVLLPLGCLSEAEELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHKFLSLPMLVRQLWDSAVSHFFSLPFKKSLLAALILCLLVVRFDPASPSSLHFLYKLAQLFRWIRKAAFSRLYQLRIRD Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 017929
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.