PF4 (Platelet Factor 4, PF-4, C-X-C Motif Chemokine 4, Iroplact, Oncostatin-A, CXCL4, SCYB4 MGC138298), Rabbit

Catalog Number: USB-131177
Article Name: PF4 (Platelet Factor 4, PF-4, C-X-C Motif Chemokine 4, Iroplact, Oncostatin-A, CXCL4, SCYB4 MGC138298), Rabbit
Biozol Catalog Number: USB-131177
Supplier Catalog Number: 131177
Alternative Catalog Number: USB-131177-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: Full length human PF4, aa1-101 (NP_002610.1).
Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation, the short form is a more potent inhibitor than the longer form. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 002619
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.