PVRL4 (Poliovirus Receptor-related Protein 4, Ig Superfamily Receptor LNIR, Nectin-4, LNIR, PRR4), Clone: [1D7], Mouse, Monoclonal

Catalog Number: USB-132111
Article Name: PVRL4 (Poliovirus Receptor-related Protein 4, Ig Superfamily Receptor LNIR, Nectin-4, LNIR, PRR4), Clone: [1D7], Mouse, Monoclonal
Biozol Catalog Number: USB-132111
Supplier Catalog Number: 132111
Alternative Catalog Number: USB-132111-200
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: Partial recombinant protein corresponding to aa31-139 from human PVRL4 with GST tag. MW of the GST tag alone is 26kD.
Seems to be involved in cell adhesion through trans-homophilic and -heterophilic interactions, the latter including specifically interactions with PVRL2/nectin-1. Does not act as receptor for alpha-Herpes virus entry into cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AGELGTSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [1D7]
NCBI: 030916
Purity: Ascites
Form: Supplied as a liquid in ascites fluid.