SAA4 (CSAA, Serum Amyloid A-4 Protein, Constitutively Expressed Serum Amyloid A Protein, C-SAA) (PE), Rabbit

Catalog Number: USB-132943-PE
Article Name: SAA4 (CSAA, Serum Amyloid A-4 Protein, Constitutively Expressed Serum Amyloid A Protein, C-SAA) (PE), Rabbit
Biozol Catalog Number: USB-132943-PE
Supplier Catalog Number: 132943-PE
Alternative Catalog Number: USB-132943-PE-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: Full length human SAA4, aa1-130 (NP_006503.1).
SAA4 is a constitutively expressed protein belonging to the SAA family. It is a major acute phase reactant and an apolipoprotein of the HDL complex. SAA4 is constitutively expressed only in humans and mice, is associated almost entirely with lipoproteins of the high density range. Its physiological function is unknown and its serum concentration has no relationship with those of other major apolipoproteins. The presence of SAA4 mRNA and protein in macrophage derived foam cells of coronary and carotid arteries suggested a specific role of human SAA4 during inflammation including atherosclerosis. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
NCBI: 006512
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).