SLC30A6 (Solute Carrier Family 30 Member 6, Zinc Transporter 6, ZNT6, ZnT-6, MST103, MSTP103), Clone: [2G6-G3], Mouse, Monoclonal

Catalog Number: USB-133475
Article Name: SLC30A6 (Solute Carrier Family 30 Member 6, Zinc Transporter 6, ZNT6, ZnT-6, MST103, MSTP103), Clone: [2G6-G3], Mouse, Monoclonal
Biozol Catalog Number: USB-133475
Supplier Catalog Number: 133475
Alternative Catalog Number: USB-133475-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA
Immunogen: Full length recombinant corresponding to aa1-217 from human SLC30A6 (AAH32525) with GST tag. MW of the GST tag alone is 26kD.
Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIPMPLLKGTDDLNPVTSTPAKPSSPPPEFSFNTPGKNVNPVILLNTQTRPYGFGLNHGHTPYSSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [2G6-G3]
NCBI: 032525
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.