SLC30A6 (Solute Carrier Family 30 Member 6, Zinc Transporter 6, ZNT6, ZnT-6, MST103, MSTP103) (APC), Clone: [2G6-G3], Mouse, Monoclonal

Catalog Number: USB-133475-APC
Article Name: SLC30A6 (Solute Carrier Family 30 Member 6, Zinc Transporter 6, ZNT6, ZnT-6, MST103, MSTP103) (APC), Clone: [2G6-G3], Mouse, Monoclonal
Biozol Catalog Number: USB-133475-APC
Supplier Catalog Number: 133475-APC
Alternative Catalog Number: USB-133475-APC-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA
Immunogen: Full length recombinant corresponding to aa1-217 from human SLC30A6 (AAH32525) with GST tag. MW of the GST tag alone is 26kD.
Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIPMPLLKGTDDLNPVTSTPAKPSSPPPEFSFNTPGKNVNPVILLNTQTRPYGFGLNHGHTPYSSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2G6-G3]
NCBI: 032525
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).