TMPRSS2 (Transmembrane Protease, Serine 2, Serine Protease 10, Transmembrane Protease, Serine 2 Non-catalytic Chain, Transmembrane Protease, Serine 2 Catalytic Chain, PRSS10, FLJ41954) (MaxLight 490), Clone: [2F4], Mouse, Monoclon

Catalog Number: USB-134524-ML490
Article Name: TMPRSS2 (Transmembrane Protease, Serine 2, Serine Protease 10, Transmembrane Protease, Serine 2 Non-catalytic Chain, Transmembrane Protease, Serine 2 Catalytic Chain, PRSS10, FLJ41954) (MaxLight 490), Clone: [2F4], Mouse, Monoclon
Biozol Catalog Number: USB-134524-ML490
Supplier Catalog Number: 134524-ML490
Alternative Catalog Number: USB-134524-ML490-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Partial recombinant protein corresponding to aa383-492 from human TMPRSS2 with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)490 is a new Blue-Green photostable dye conjugate comparable to DyLight(TM)488, Alexa Fluor(TM)488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm), Emission (515nm), Extinction Coefficient 73,000. TMPRSS2 is a protein that belongs to the serine protease family. The protein contains a type II transmembrane domain, a receptor class A domain, a scavenger receptor cysteine-rich domain and a protease domain. Serine proteases are known to be involved in many physiological and pathological processes. Its gene was demonstrated to be up-regulated by androgenic hormones in prostate cancer cells and down-regulated in androgen-independent prostate cancer tissue. The protease domain of this protein is thought to be cleaved and secreted into cell media after autocleavage. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: GWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2F4]
NCBI: 005656
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)490.