TNFSF11 (Tumor Necrosis Factor Ligand Superfamily Member 11, CD254, Osteoclast Differentiation Factor, ODF, Osteoprotegerin Ligand, OPGL, Receptor Activator of Nuclear Factor kappa-B Ligand, RANKL, TNF-related Activation-induced C

Catalog Number: USB-134549
Article Name: TNFSF11 (Tumor Necrosis Factor Ligand Superfamily Member 11, CD254, Osteoclast Differentiation Factor, ODF, Osteoprotegerin Ligand, OPGL, Receptor Activator of Nuclear Factor kappa-B Ligand, RANKL, TNF-related Activation-induced C
Biozol Catalog Number: USB-134549
Supplier Catalog Number: 134549
Alternative Catalog Number: USB-134549-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: Partial recombinant corresponding to aa222-317 from TNFSF11 (NP_003692) with GST tag. MW of the GST tag alone is 26kD.
Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDI* Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [3F7]
NCBI: 003701
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.