TRPV5 (Transient Receptor Potential Cation Channel Subfamily V Member 5, TrpV5, Calcium Transport Protein 2, CaT2, Epithelial Calcium Channel 1, ECaC1, ECaC, Osm-9-like TRP Channel 3, OTRPC3) (MaxLight 650), Clone: [2A6], Mouse, M

Catalog Number: USB-134793-ML650
Article Name: TRPV5 (Transient Receptor Potential Cation Channel Subfamily V Member 5, TrpV5, Calcium Transport Protein 2, CaT2, Epithelial Calcium Channel 1, ECaC1, ECaC, Osm-9-like TRP Channel 3, OTRPC3) (MaxLight 650), Clone: [2A6], Mouse, M
Biozol Catalog Number: USB-134793-ML650
Supplier Catalog Number: 134793-ML650
Alternative Catalog Number: USB-134793-ML650-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Partial recombinant corresponding to aa1-101 from human TRPV5 (NP_062815) with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor(TM)647, DyLight(TM)649, Cy5(TM) and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm), Emission (676nm), Extinction Coefficient 250,000. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGGFLPKAEGPGSQLQKLLPSFLVREQDWDQHLDKLHMLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAALYDNLEAALVLME Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2A6]
NCBI: 019841
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)650.