UHRF1 (Ubiquitin-like PHD and RING Finger Domain-containing Protein 1, Ubiquitin-like-containing PHD and RING Finger Domains Protein 1, hUHRF1, E3 Ubiquitin-protein Ligase UHRF1, Inverted CCAAT Box-binding Protein of 90kD, ICBP90,

Catalog Number: USB-135082-PE
Article Name: UHRF1 (Ubiquitin-like PHD and RING Finger Domain-containing Protein 1, Ubiquitin-like-containing PHD and RING Finger Domains Protein 1, hUHRF1, E3 Ubiquitin-protein Ligase UHRF1, Inverted CCAAT Box-binding Protein of 90kD, ICBP90,
Biozol Catalog Number: USB-135082-PE
Supplier Catalog Number: 135082-PE
Alternative Catalog Number: USB-135082-PE-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, IF, IHC, WB
Immunogen: Partial recombinant corresponding to aa694-794 from human UHRF1 (NP_037414) with GST tag. MW of the GST tag alone is 26kD.
Applications: Suitable for use in FLISA, Western Blot, Immunohistochemistry and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR* Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [3A11]
NCBI: 013282
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).