UNKL (Putative E3 Ubiquitin-protein Ligase UNKL, RING Finger Protein Unkempt-like, Zinc Finger CCCH Domain-containing Protein 5-like, ZC3H5L, ZC3HDC5L, C16orf28), Mouse

Catalog Number: USB-135115
Article Name: UNKL (Putative E3 Ubiquitin-protein Ligase UNKL, RING Finger Protein Unkempt-like, Zinc Finger CCCH Domain-containing Protein 5-like, ZC3H5L, ZC3HDC5L, C16orf28), Mouse
Biozol Catalog Number: USB-135115
Supplier Catalog Number: 135115
Alternative Catalog Number: USB-135115-50
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: WB
Immunogen: Full length human UNKL, aa1-277 (NP_001032202).
Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPSVSKAAAAALSGSPPQTEKPTHYRYLKEFRTEQCPLFSQHKCAQHRPFTCFHWHFLNQRRRRPLRRRDGTFNYSPDVYCSKYNEATGVCPDGDECPYLHRTTGDTERKYHLRYYKTGTCIHETDARGHCVKNGLHCAFAHGPLDLRPPVCDVRELQAQEALQNGQLGGGEGVPDLQPGVLASQAMIEKILSEDPRWQDANFVLGSYKTEQCPKPPRLCRQGYACPHYHNSRDRRRNPRRFQYSWQLGRRVLRLSPRANNPRVALPRVHTGPSSTA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 001037125
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.