USP20 (Ubiquitin-specific-processing Protease 20, Ubiquitin Carboxyl-terminal Hydrolase 20, Deubiquitinating Enzyme 20, Ubiquitin Thioesterase 20, VHL-interacting Deubiquitinating Enzyme 2, VDU2, hVDU2, KIAA1003, LSFR3A), Clone: [

Product Overview

• Article Name: USP20 (Ubiquitin-specific-processing Protease 20, Ubiquitin Carboxyl-terminal Hydrolase 20, Deubiquitinating Enzyme 20, Ubiquitin Thioesterase 20, VHL-interacting Deubiquitinating Enzyme 2, VDU2, hVDU2, KIAA1003, LSFR3A), Clone: [
• Biozol Catalog Number: USB-135162
• Supplier Catalog Number: 135162
• Alternative Catalog Number: USB-135162-100
• Manufacturer: US Biological
• Host: Mouse
• Category: Antikörper
• Application: ELISA, WB
• Immunogen: Partial recombinant corresponding to aa252-349 from human USP20 (NP_001008563) with GST tag. MW of the GST tag alone is 26kD.

Product Description

Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDAD Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [1A6]
• NCBI: 001008563
• Purity: Purified by Protein A affinity chromatography.
• Form: Supplied as a liquid in PBS, pH 7.2.