USP20 (Ubiquitin-specific-processing Protease 20, Ubiquitin Carboxyl-terminal Hydrolase 20, Deubiquitinating Enzyme 20, Ubiquitin Thioesterase 20, VHL-interacting Deubiquitinating Enzyme 2, VDU2, hVDU2, KIAA1003, LSFR3A) (HRP), Cl

Product Overview

• Article Name: USP20 (Ubiquitin-specific-processing Protease 20, Ubiquitin Carboxyl-terminal Hydrolase 20, Deubiquitinating Enzyme 20, Ubiquitin Thioesterase 20, VHL-interacting Deubiquitinating Enzyme 2, VDU2, hVDU2, KIAA1003, LSFR3A) (HRP), Cl
• Biozol Catalog Number: USB-135162-HRP
• Supplier Catalog Number: 135162-HRP
• Alternative Catalog Number: USB-135162-HRP-100
• Manufacturer: US Biological
• Host: Mouse
• Category: Antikörper
• Application: ELISA, WB
• Immunogen: Partial recombinant corresponding to aa252-349 from human USP20 (NP_001008563) with GST tag. MW of the GST tag alone is 26kD.

Product Description

Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDAD Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [1A6]
• NCBI: 001008563
• Purity: Purified by Protein A affinity chromatography.
• Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).