NEDD9 (Neural Precursor Cell Expressed Developmentally Down-regulated protein 9, Enhancer of Filamentation 1, hEF1, CRK-associated Substrate-related Protein, CAS-L, CasL, Cas Scaffolding Protein Family Member 2, NEDD-9, Renal Carc

Catalog Number: USB-138173-APC
Article Name: NEDD9 (Neural Precursor Cell Expressed Developmentally Down-regulated protein 9, Enhancer of Filamentation 1, hEF1, CRK-associated Substrate-related Protein, CAS-L, CasL, Cas Scaffolding Protein Family Member 2, NEDD-9, Renal Carc
Biozol Catalog Number: USB-138173-APC
Supplier Catalog Number: 138173-APC
Alternative Catalog Number: USB-138173-APC-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: Middle region of NEDD9 corresponding to HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH
Variation in NEDD9 is associated wih susceptibility to late-onset Alzheimer and Parkinson diseases. Changes in expression of the scaffold protein HEF1/CAS-L/NEDD9 were found to be a potent prometastatic stimulus in melanoma and other cancers. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 5ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).