NEDD9 (Neural Precursor Cell Expressed Developmentally Down-regulated protein 9, Enhancer of Filamentation 1, hEF1, CRK-associated Substrate-related Protein, CAS-L, CasL, Cas Scaffolding Protein Family Member 2, NEDD-9, Renal Carc

Catalog Number: USB-138173-HRP
Article Name: NEDD9 (Neural Precursor Cell Expressed Developmentally Down-regulated protein 9, Enhancer of Filamentation 1, hEF1, CRK-associated Substrate-related Protein, CAS-L, CasL, Cas Scaffolding Protein Family Member 2, NEDD-9, Renal Carc
Biozol Catalog Number: USB-138173-HRP
Supplier Catalog Number: 138173-HRP
Alternative Catalog Number: USB-138173-HRP-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: Middle region of NEDD9 corresponding to HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH
Variation in NEDD9 is associated wih susceptibility to late-onset Alzheimer and Parkinson diseases. Changes in expression of the scaffold protein HEF1/CAS-L/NEDD9 were found to be a potent prometastatic stimulus in melanoma and other cancers. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 5ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).