SLC22A7 (Solute Carrier Family 22 Member 7, Novel Liver Transporter, Organic Anion Transporter 2, hOAT2, NLT, OAT2, MGC24091, MGC45202) (MaxLight 650), Rabbit

Catalog Number: USB-138356-ML650
Article Name: SLC22A7 (Solute Carrier Family 22 Member 7, Novel Liver Transporter, Organic Anion Transporter 2, hOAT2, NLT, OAT2, MGC24091, MGC45202) (MaxLight 650), Rabbit
Biozol Catalog Number: USB-138356-ML650
Supplier Catalog Number: 138356-ML650
Alternative Catalog Number: USB-138356-ML650-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: Synthetic peptide corresponding to LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQS
MaxLight(TM) 650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor(TM)647, DyLight(TM)649, Cy5(TM) and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm), Emission (676nm), Extinction Coefficient 250,000. SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 5ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)650.