CA9 (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN), Rabbit

Catalog Number: USB-139554
Article Name: CA9 (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN), Rabbit
Biozol Catalog Number: USB-139554
Supplier Catalog Number: 139554
Alternative Catalog Number: USB-139554-200
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC, WB
Immunogen: Recombinant protein corresponding to aa59-414 with two N-Terminal Tags, His-Tag and T7-Tag from human CA9, expressed in E.coli.
Applications: Suitable for use in ELISA, Western Blot, Immunohistochemistry and Immunocytochemistry. Other applications not tested. Recommended Dilutions: ELISA: 1:100-1:5000 Western Blot: 1:150-1:400 Immunohistochemistry (frozen): 1:50-1:500 Immunohistochemistry (Paraffin): 1:10-1:100 Immunocytochemistry: 1:50-1:500 Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFELRRQ-PL GEEDLPSEED SPREEDPPGE EDLPGEEDLP GEEDLPEVKP KSEEEGSLKL EDLPTVEAPG DPQEPQNNAH RDKEGDDQSH WRYGGDPPWP RVSPACAGRF QSPVDIRPQL AAFCPALRPL ELLGFQLPPL PELRLRNNGH SVQLTLPPGL EMALGPGREY RALQLHLHWG AAGRPGSEHT VEGHRFPAEI HVVHLSTAFA RVDEALGRPG GLAVLAAFLE EGPEENSAYE QLLSRLEEIAEEGSETQVPG LDISALLPSD FSRYFQYEGS LTTPPCAQGV IWTVFNQTVM LSAKQLHTLS DTLWGPGDSR LQLNFRATQP LNGRVIEASF PAGVDSSPRA AEPVQLNSCL AAGD Positive Control (Supplied): 139554A: Suppled as a recombinant protein (aa59-414) in loading buffer (100mM Tris, pH 8.8, 2% SDS, 200mM sodium chloride, 0.01% BPB, 0.02% sodium azide, 50% glycerol). DAB: 10ul/well ECL: 5ul/well Store at -20C. Stable for 6 months after receipt. Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Purity: Purified by affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.4, 0.02% sodium azide, 50% glycerol.