Protein Z Dependent Protease Inhibitor (ZPI) Recombinant, Rat

Catalog Number: USB-156536
Article Name: Protein Z Dependent Protease Inhibitor (ZPI) Recombinant, Rat
Biozol Catalog Number: USB-156536
Supplier Catalog Number: 156536
Alternative Catalog Number: USB-156536-10,USB-156536-50,USB-156536-200
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant Rat from E. coli Accession No: Q62975 Fragment: His278~Leu425 (Accession No: Q62975) Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-HIL KLPYQGNATM LVVLMEKSGD HLALEDYLTT DLVEMWLQDM KTRKMEVFFP KFKLNQRYEM HELLKQVGIR RIFSTSADLS ELSAVARNLQ VSKVVQQSVL EVDERGTEVV SGTVSEITAY CMPPVIKVDR PFHFIIYEEM SQMLL Epitope Tag: N-terminal Tags: His-tag and S-tag Molecular Weight: 22.8kD Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -70C. Reconstitute with sterile PBS. Aliquot to avoid repeated freezing and thawing. Store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
Molecular Weight: 22.8
UniProt: Q62975
Purity: 95%. Endotoxin: 1EU/ug (LAL).
Form: Supplied as lyophilized powder from PBS, pH 7.4, 1mM DTT, 5% trehalose, 0.01% sarcosyl, 0.05% Proclin-300. Reconstitute with sterile PBS to a concentration of 0.1-1mg/ml. Do not vortex.