Source: Recombinant Mouse from E. coli Accession No: Q99P87 Fragment: Ser21~Ser114 (Accession No: Q99P87) Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-SSMPLCPIDE AIDKKIKQDF NSLFPNAIKN IGLNCWTVSS RGKLASCPEG TAVLSCSCGS ACGSWDIREE KVCHCQCARI DWTAARCCKL QVAS Epitope Tag: N-terminal Tags: His-tag and T7-tag Molecular Weight: 14.0kD Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -70C. Reconstitute with sterile 20mM Tris, 150mM sodium chloride, pH 8.0.. Aliquot to avoid repeated freezing and thawing. Store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
Supplied as lyophilized powder from 20mM Tris, 150mM sodium chloride, pH 8.0, 1mM EDTA, 1mM DTT, 5% trehalose, 0.01% sarcosyl, 0.05% Proclin-300. Reconstitute with sterile 20mM Tris, 150mM sodium chloride, pH 8.0 to a concentration of 0.1-1mg/ml. Do not v
* VAT and and shipping costs not included. Errors and price changes excepted