EPHA2 (ECK, EPH Receptor A2, Ephrin Receptor EphA2, Epithelial Cell Receptor Protein Tyrosine Kinase, Protein Tyrosine Kinase, Receptor Protein Tyrosine Kinase Regulated by p53 and E2F-1, Soluble EPHA2 Variant 1), Clone: [6F8], Mo

Catalog Number: USB-207592
Article Name: EPHA2 (ECK, EPH Receptor A2, Ephrin Receptor EphA2, Epithelial Cell Receptor Protein Tyrosine Kinase, Protein Tyrosine Kinase, Receptor Protein Tyrosine Kinase Regulated by p53 and E2F-1, Soluble EPHA2 Variant 1), Clone: [6F8], Mo
Biozol Catalog Number: USB-207592
Supplier Catalog Number: 207592
Alternative Catalog Number: USB-207592-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: Recombinant protein corresponding to aa204-326 from human EPHA2 with GST tag. MW of the GST tag alone is 26kD.
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGG EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQAC SPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGF FRAPQDPASMPCT Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [6F8]
NCBI: 37166
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.4.