EPHA2 (ECK, EPH Receptor A2, Ephrin Receptor EphA2, Epithelial Cell Receptor Protein Tyrosine Kinase, Protein Tyrosine Kinase, Receptor Protein Tyrosine Kinase Regulated by p53 and E2F-1, Soluble EPHA2 Variant 1) (PE), Clone: [6F8

Catalog Number: USB-207592-PE
Article Name: EPHA2 (ECK, EPH Receptor A2, Ephrin Receptor EphA2, Epithelial Cell Receptor Protein Tyrosine Kinase, Protein Tyrosine Kinase, Receptor Protein Tyrosine Kinase Regulated by p53 and E2F-1, Soluble EPHA2 Variant 1) (PE), Clone: [6F8
Biozol Catalog Number: USB-207592-PE
Supplier Catalog Number: 207592-PE
Alternative Catalog Number: USB-207592-PE-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Recombinant protein corresponding to aa204-326 from human EPHA2 with GST tag. MW of the GST tag alone is 26kD.
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGG EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQAC SPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGF FRAPQDPASMPCT Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [6F8]
NCBI: 37166
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).