EPHB3 (EPH Receptor B3, EPH-like Tyrosine Kinase-2, Ephrin Receptor EphB3, Human Embryo Kinase 2, ETK2, HEK2, TYRO6) (PE), Clone: [4E9], Mouse, Monoclonal

Catalog Number: USB-207597-PE
Article Name: EPHB3 (EPH Receptor B3, EPH-like Tyrosine Kinase-2, Ephrin Receptor EphB3, Human Embryo Kinase 2, ETK2, HEK2, TYRO6) (PE), Clone: [4E9], Mouse, Monoclonal
Biozol Catalog Number: USB-207597-PE
Supplier Catalog Number: 207597-PE
Alternative Catalog Number: USB-207597-PE-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, IHC, WB
Immunogen: Recombinant protein corresponding to aa899-997 from human EPHB3 with GST tag. MW of the GST tag alone is 26kD.
Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQ Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [4E9]
NCBI: 004434
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).