FASLG (Fas Ligand (TNF Superfamily, Member 6), APT1LG1, CD178, CD95L, FASL, TNFSF6, CD95 Ligand, OTTHUMP00000032708, Apoptosis (APO-1) Antigen Ligand 1, Fas Ligand, Tumor Necrosis Factor (Ligand) Superfamily, Member 6) (FITC), Clo

Catalog Number: USB-207604-FITC
Article Name: FASLG (Fas Ligand (TNF Superfamily, Member 6), APT1LG1, CD178, CD95L, FASL, TNFSF6, CD95 Ligand, OTTHUMP00000032708, Apoptosis (APO-1) Antigen Ligand 1, Fas Ligand, Tumor Necrosis Factor (Ligand) Superfamily, Member 6) (FITC), Clo
Biozol Catalog Number: USB-207604-FITC
Supplier Catalog Number: 207604-FITC
Alternative Catalog Number: USB-207604-FITC-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA
Immunogen: Recombinant protein corresponding to aa172-281 from human FASLG with GST tag. MW of the GST tag alone is 26kD.
The protein encoded by this gene is the ligand for FAS. Both are transmembrane proteins. Interaction of FAS with this ligand is critical in triggering apoptosis of some types of cells such as lymphocytes. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLS HKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSS YLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [3F3]
NCBI: 17502
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).