SLC2A4 (Solute Carrier Family 2 (Facilitated glucose Transporter), Member 4, Glucose Transporter 4, Insulin-responsive Glucose Transporter Type 4, GLUT4) (APC), Clone: [2D6], Mouse, Monoclonal

Catalog Number: USB-207881-APC
Article Name: SLC2A4 (Solute Carrier Family 2 (Facilitated glucose Transporter), Member 4, Glucose Transporter 4, Insulin-responsive Glucose Transporter Type 4, GLUT4) (APC), Clone: [2D6], Mouse, Monoclonal
Biozol Catalog Number: USB-207881-APC
Supplier Catalog Number: 207881-APC
Alternative Catalog Number: USB-207881-APC-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Recombinant protein corresponding to aa467-509 from human SLC2A4 with GST tag. MW of the GST tag alone is 26kD.
This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2D6]
NCBI: 001033
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).