ABHD6 (Abhydrolase Domain Containing 6), Mouse

Catalog Number: USB-242988
Article Name: ABHD6 (Abhydrolase Domain Containing 6), Mouse
Biozol Catalog Number: USB-242988
Supplier Catalog Number: 242988
Alternative Catalog Number: USB-242988-50
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: WB
Immunogen: ABHD6 (AAH01698.1, 1aa-337aa) full-length human protein.
Mouse polyclonal antibody raised against a full-length human ABHD6 protein. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 01698
Purity: Ascites
Form: Supplied as a liquid. No preservative added.