ADORA2A (Adenosine A2a Receptor, ADORA2, RDC8, hA2aR), Mouse

Catalog Number: USB-243122
Article Name: ADORA2A (Adenosine A2a Receptor, ADORA2, RDC8, hA2aR), Mouse
Biozol Catalog Number: USB-243122
Supplier Catalog Number: 243122
Alternative Catalog Number: USB-243122-50
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: WB
Immunogen: ADORA2A (NP_000666, 1aa-412aa) full-length human protein.
This gene encodes a protein which is one of several receptor subtypes for adenosine. The activity of the encoded protein, a G-protein coupled receptor family member, is mediated by G proteins which activate adenylyl cyclase. The encoded protein is abundant in basal ganglia, vasculature and platelets and it is a major target of caffeine. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLMouse polyclonal antibody raised against a full-length human ADORA2A protein.DIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 000666
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.4.