CLK3 (CDC-like Kinase 3, FLJ22858, PHCLK3, PHCLK3/152) (PE), Clone: [7D6], Mouse, Monoclonal

Catalog Number: USB-244769-PE
Article Name: CLK3 (CDC-like Kinase 3, FLJ22858, PHCLK3, PHCLK3/152) (PE), Clone: [7D6], Mouse, Monoclonal
Biozol Catalog Number: USB-244769-PE
Supplier Catalog Number: 244769-PE
Alternative Catalog Number: USB-244769-PE-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, IF, IHC, WB
Immunogen: CLK3 (AAH02555, 36aa-136aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
This gene encodes a protein belonging to the serine/threonine type protein kinase family. This protein is a nuclear dual-specificity kinase that regulates the intranuclear distribution of the serine/arginine-rich (SR) family of splicing factors. Two transcript variants encoding different isoforms have been found for this gene. Related pseudogenes are located on chromosomes 1 and 9. [provided by RefSeq Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot, Immunohistochemistry. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [7D6]
NCBI: 02555
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).