CLU (Clusterin, AAG4, APOJ, CLI, KUB1, MGC24903, SGP-2, SGP2, SP-40, TRPM-2, TRPM2), Mouse

Catalog Number: USB-244779
Article Name: CLU (Clusterin, AAG4, APOJ, CLI, KUB1, MGC24903, SGP-2, SGP2, SP-40, TRPM-2, TRPM2), Mouse
Biozol Catalog Number: USB-244779
Supplier Catalog Number: 244779
Alternative Catalog Number: USB-244779-50
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: WB
Immunogen: CLU (ABM85549.1, 1aa-449aa) full-length human protein.
Mouse polyclonal antibody raised against a full-length human CLU protein. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 85549
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.4.