CMTM4 (CKLF-like MARVEL Transmembrane Domain Containing 4, CKLFSF4) (APC), Clone: [1B9], Mouse, Monoclonal

Catalog Number: USB-244786-APC
Article Name: CMTM4 (CKLF-like MARVEL Transmembrane Domain Containing 4, CKLFSF4) (APC), Clone: [1B9], Mouse, Monoclonal
Biozol Catalog Number: USB-244786-APC
Supplier Catalog Number: 244786-APC
Alternative Catalog Number: USB-244786-APC-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: CMTM4 (NP_848933, 173aa-234aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq. Applications: Suitable for use in FLISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQLA Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [1B9]
NCBI: 848933
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).