CNAP1 (non-SMC Condensin I Complex, Subunit D2, CAP-D2, CNAP1, KIAA0159, hCAP-D2) (Biotin), Clone: [4C9], Mouse, Monoclonal

Catalog Number: USB-244790-BIOTIN
Article Name: CNAP1 (non-SMC Condensin I Complex, Subunit D2, CAP-D2, CNAP1, KIAA0159, hCAP-D2) (Biotin), Clone: [4C9], Mouse, Monoclonal
Biozol Catalog Number: USB-244790-BIOTIN
Supplier Catalog Number: 244790-Biotin
Alternative Catalog Number: USB-244790-BIOTIN-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA
Immunogen: CNAP1 (AAH28182, 1240aa-1339aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Mouse monoclonal antibody raised against a partial recombinant CNAP1. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LRKMLDNFDCFGDKLSDESIFSAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSSGSRYQPLASTASDNDFVT Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [4C9]
NCBI: 28182
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.