CNDP1 (carnosine Dipeptidase 1 (Metallopeptidase M20 Family), CN1, CPGL2, HsT2308, MGC102737, MGC10825, MGC142072), Rabbit

Catalog Number: USB-244791
Article Name: CNDP1 (carnosine Dipeptidase 1 (Metallopeptidase M20 Family), CN1, CPGL2, HsT2308, MGC102737, MGC10825, MGC142072), Rabbit
Biozol Catalog Number: USB-244791
Supplier Catalog Number: 244791
Alternative Catalog Number: USB-244791-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: IP, WB
Immunogen: CNDP1 (NP_116038.4, 1aa-507aa) full-length human protein.
This gene encodes a member of the M20 metalloprotease family. The encoded protein is specifically expressed in the brain, is a homodimeric dipeptidase which was identified as human carnosinase. This gene contains trinucleotide (CTG) repeat length polymorphism in the coding region. [provided by RefSeq Applications: Suitable for use in Western Blot, Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDPKLGRMAASLLAVLLLLLERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQLH Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 116038
Purity: Purified
Form: Supplied as a liquid. No preservative added.