CNDP2 (CNDP Dipeptidase 2 (Metallopeptidase M20 Family), CN2, CPGL, FLJ10830, HsT2298, PEPA) (MaxLight 490), Clone: [1A6], Mouse, Monoclonal

Catalog Number: USB-244793-ML490
Article Name: CNDP2 (CNDP Dipeptidase 2 (Metallopeptidase M20 Family), CN2, CPGL, FLJ10830, HsT2298, PEPA) (MaxLight 490), Clone: [1A6], Mouse, Monoclonal
Biozol Catalog Number: USB-244793-ML490
Supplier Catalog Number: 244793-ML490
Alternative Catalog Number: USB-244793-ML490-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: CNDP2 (NP_060705, 191aa-300aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)490 is a new Blue-Green photostable dye conjugate comparable to DyLight(TM)488, Alexa Fluor(TM)488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm), Emission (515nm), Extinction Coefficient 73,000. CNDP2, also known as tissue carnosinase and peptidase A (EC 3.4.13.18), is a nonspecific dipeptidase rather than a selective carnosinase (Teufel et al., 2003 [PubMed 12473676]).[supplied by OMIM Applications: Suitable for use in FLISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VCISDNYWLGKKKPCITYGLRGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDIDFDIEEFAKDVGAQILLHSH Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [1A6]
NCBI: 060705
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)490.