CNOT2 (CCR4-NOT Transcription Complex, Subunit 2, CDC36, HSPC131, NOT2, NOT2H) (FITC), Clone: [2.0e+10], Mouse, Monoclonal

Catalog Number: USB-244805-FITC
Article Name: CNOT2 (CCR4-NOT Transcription Complex, Subunit 2, CDC36, HSPC131, NOT2, NOT2H) (FITC), Clone: [2.0e+10], Mouse, Monoclonal
Biozol Catalog Number: USB-244805-FITC
Supplier Catalog Number: 244805-FITC
Alternative Catalog Number: USB-244805-FITC-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA
Immunogen: CNOT2 (NP_055330, 441aa-540aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Mouse monoclonal antibody raised against a partial recombinant CNOT2. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQAF Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2.0e+10]
NCBI: 055330
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).